PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI07G19860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 457aa    MW: 49096.6 Da    PI: 5.5968
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI07G19860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3611.7e-110694342374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lLl+cAeav+ ++l +a+ lL ++ elasp g++ +R+aayf  AL ar+++s  + y+ l+ ++ +  +s +   a+++++ +sP++kfsh
  ORUFI07G19860.1  69 LSLLLRCAEAVAMDQLPEARDLLPEIAELASPFGSSPERVAAYFGDALCARVLSSYLGAYSPLALRPLAAAQSRRISGAFQAYNALSPLVKFSH 162
                      689******************************************************************999********************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      +taNqaI +a++ge+rvH+iD+di+qGlQWp L++ LasRp +p slRiTg+g+    s + le+tg+rLa+fA++lg+pfef+++  k  +  
  ORUFI07G19860.1 163 FTANQAIFQALDGEDRVHVIDLDIMQGLQWPGLFHILASRPTKPRSLRITGLGA----SLDVLEATGRRLADFAASLGLPFEFRPIEGKIGHVA 252
                      ******************************************************....9**************************766655555 PP

             GRAS 190 eleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres.. 279
                      +  +L   +  gEa++V++++  h l+d ++s +     +++l+ksl+Pk++++veq++ h s++Fl rf+eal+yysalfd+l  ++++++  
  ORUFI07G19860.1 253 DAAALLGPRhhGEATVVHWMH--HCLYDVTGSDAG----TVRLLKSLRPKLITIVEQDLGH-SGDFLGRFVEALHYYSALFDALGDGAGAAEee 339
                      66666443358*********9..888888888888....**********************.899*******************5443333323 PP

             GRAS 280 .eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                        er+ vEr+llg ei+n+va  g +r+ + + +e+W + l++aGF+pv+l  + a+qa+lll +++++gy++ ee+g+l lgWkd +L+++S+
  ORUFI07G19860.1 340 aAERHAVERQLLGAEIRNIVAVGGPKRTGEVR-VERWGDELRRAGFRPVTLAGSPAAQARLLLGMYPWKGYTLVEEDGCLKLGWKDLSLLTASS 432
                      699***********************998887.9************************************************************ PP

             GRAS 373 Wr 374
                      W+
  ORUFI07G19860.1 433 WE 434
                      *5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.63842414IPR005202Transcription factor GRAS
PfamPF035145.9E-10869434IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MLQGVLSRAP GADAAAMKAK RAADDEEEGG ERERARGKRL AAEGKQGLVV VSTGEEEEAA  60
AETRGLRLLS LLLRCAEAVA MDQLPEARDL LPEIAELASP FGSSPERVAA YFGDALCARV  120
LSSYLGAYSP LALRPLAAAQ SRRISGAFQA YNALSPLVKF SHFTANQAIF QALDGEDRVH  180
VIDLDIMQGL QWPGLFHILA SRPTKPRSLR ITGLGASLDV LEATGRRLAD FAASLGLPFE  240
FRPIEGKIGH VADAAALLGP RHHGEATVVH WMHHCLYDVT GSDAGTVRLL KSLRPKLITI  300
VEQDLGHSGD FLGRFVEALH YYSALFDALG DGAGAAEEEA AERHAVERQL LGAEIRNIVA  360
VGGPKRTGEV RVERWGDELR RAGFRPVTLA GSPAAQARLL LGMYPWKGYT LVEEDGCLKL  420
GWKDLSLLTA SSWEPTDGDA DADVAVAGDT HHESHDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-49684334374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0038660.0AP003866.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1092_A07.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644982.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ11e-173SCL23_ARATH; Scarecrow-like protein 23
TrEMBLA0A0P0X7S90.0A0A0P0X7S9_ORYSJ; Os07g0567700 protein
TrEMBLA0A0E0I2G60.0A0A0E0I2G6_ORYNI; Uncharacterized protein
TrEMBLA0A0E0QA150.0A0A0E0QA15_ORYRU; Uncharacterized protein
STRINGLOC_Os07g38030.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.11e-155GRAS family protein